Iright
BRAND / VENDOR: Proteintech

Proteintech, 23937-1-AP, ACIN1 Polyclonal antibody

CATALOG NUMBER: 23937-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ACIN1 (23937-1-AP) by Proteintech is a Polyclonal antibody targeting ACIN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23937-1-AP targets ACIN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Apoptosis is defined by several morphologic nuclear changes, including chromatin condensation and nuclear fragmentation. ACIN1 is a nuclear protein that induces apoptotic chromatin condensation after activation by caspase-3, without inducing DNA fragmentation. This protein has also been shown to be a component of a splicing-dependent multiprotein exon junction complex (EJC) that is deposited at splice junctions on mRNAs, as a consequence of pre-mRNA splicing. There are three isoforms of human acinus (the L, S and S' forms) shows at about 80-85 kDa and 220-250 kDa by Western Blot, which were probably generated by alternative splicing (PMID: 10490026). 23937-1-AP can detect all three isoforms of ACIN1. Another antibody 30522-1-AP specificly targets at the ACIN1-L. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21036 Product name: Recombinant human ACIN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 979-1328 aa of BC140805 Sequence: TIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR Predict reactive species Full Name: apoptotic chromatin condensation inducer 1 Calculated Molecular Weight: 1341 aa, 152 kDa Observed Molecular Weight: 250 kDa, 80-85 kDa GenBank Accession Number: BC140805 Gene Symbol: ACIN1 Gene ID (NCBI): 22985 RRID: AB_3085716 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKV3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924