Iright
BRAND / VENDOR: Proteintech

Proteintech, 23969-1-AP, RCOR2 Polyclonal antibody

CATALOG NUMBER: 23969-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RCOR2 (23969-1-AP) by Proteintech is a Polyclonal antibody targeting RCOR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23969-1-AP targets RCOR2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells Positive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information In mammals, the CoREST (corepressor for element-1-silencing transcription factor) complex is a chromatin-modifying structure that, through interactions with NRSF (neuron restrictive silencer factor), regulates neuronal gene expression and neuronal cell fate. RCOR2 (REST corepressor 2) and RCOR3 (REST corepressor 3) are nuclear proteins that each contain one ELM2 domain and two SANT domains. RCOR2 and RCOR3, both members of the CoREST family, are thought to function as components of the CoREST complex, possibly playing a role in the transcriptional repression of neuronal genes. Additionally, RCOR2 and RCOR3, in conjunction with CoREST, can form immunocomplexes with a variety of histone-modifying genes, including G9a and HDAC1. Via these protein complexes, RCOR2 and RCOR3 can further regulate transcription by controlling the methylation and demethylation of target genes during early development. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21112 Product name: Recombinant human RCOR2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 175-523 aa of BC023587 Sequence: SWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPADPKREPLPSRPLNARPGPGKKEVQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQVQSMKQTNSSLRQALEGGIDPLRPPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPGAPVPMEEARRGAPLPAPALEEDDEVQITSVSTSVPRSVPPAPPPPPPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLIRPALAAPRHSARPGPQPPPTLIGAPLEPPAPSL Predict reactive species Full Name: REST corepressor 2 Calculated Molecular Weight: 523 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC023587 Gene Symbol: RCOR2 Gene ID (NCBI): 283248 RRID: AB_2879382 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8IZ40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924