Iright
BRAND / VENDOR: Proteintech

Proteintech, 23976-1-AP, BARHL2 Polyclonal antibody

CATALOG NUMBER: 23976-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BARHL2 (23976-1-AP) by Proteintech is a Polyclonal antibody targeting BARHL2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 23976-1-AP targets BARHL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, NIH/3T3 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BARHL2 also named as BarH like homeobox 2 is 279 amino acid protein, which contains 1 homeobox DNA-binding domain. BARHL2 localizes in nucleus and belongs to BAR homeobox family. BARHL2 as a transcription factor binds optimally to the DNA consensus sequence. Barx2 may differentially control the expression of L1 and other target genes during embryonic development. Barx2 is expressed in several smooth muscle-containing tissues, as well as skeletal muscle, brain, tongue and esophagus. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21156 Product name: Recombinant human BARHL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC126439 Sequence: MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTSS Predict reactive species Full Name: BarH-like homeobox 2 Calculated Molecular Weight: 387 aa, 42 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC126439 Gene Symbol: BARHL2 Gene ID (NCBI): 343472 RRID: AB_2879386 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9NY43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924