Proteintech, 23989-1-AP, BRMS1L Polyclonal antibody

Size: 20ul / 150ul The BRMS1L (23989-1-AP) by Proteintech is a Polyclonal antibody targeting BRMS1L in WB, ELISA applications with reactivity to human samples 23989-1-AP targets BRMS1L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21145 Product name: Recombinant human BRMS1L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-323 aa of BC006250 Sequence: MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS Predict reactive species Full Name: breast cancer metastasis-suppressor 1-like Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC006250 Gene Symbol: BRMS1L Gene ID (NCBI): 84312 RRID: AB_2879390 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q5PSV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.