Proteintech, 23995-1-AP, FNDC5 Polyclonal antibody

Size: 20ul / 150ul The FNDC5 (23995-1-AP) by Proteintech is a Polyclonal antibody targeting FNDC5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 23995-1-AP targets FNDC5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse stomach tissue, mouse skeletal muscle tissue, rat liver tissue Positive IHC detected in: mouse skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information fibronectin type III domain containing 5(FNDC5)encodes 23kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. The exercise induces muscle FNDC5 expression. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21195 Product name: Recombinant human FNDC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-76 aa of BC062297 Sequence: SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR Predict reactive species Full Name: fibronectin type III domain containing 5 Calculated Molecular Weight: 212 aa, 24 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC062297 Gene Symbol: FNDC5 Gene ID (NCBI): 252995 RRID: AB_2879394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NAU1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.