Proteintech, 23996-1-AP, TFAM Polyclonal antibody

Size: 20ul / 150ul The TFAM (23996-1-AP) by Proteintech is a Polyclonal antibody targeting TFAM in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 23996-1-AP targets TFAM in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HL-60 cells, HeLa cells, MCF-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TFAM, also named as TCF6L2, MtTF1, TCF6, TCF6L1, TCF6L3 and mtTFA, is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. It is involved in mitochondrial transcription regulation. TFAM is required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It activates transcription by binding immediately upstream of transcriptional start sites. TFAM is able to unwind and bend DNA. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21196 Product name: Recombinant human TFAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-118 aa of BC126366 Sequence: PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK Predict reactive species Full Name: transcription factor A, mitochondrial Calculated Molecular Weight: 246 aa, 29 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC126366 Gene Symbol: TFAM Gene ID (NCBI): 7019 RRID: AB_2879395 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q00059 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.