Iright
BRAND / VENDOR: Proteintech

Proteintech, 24009-1-AP, GPR108 Polyclonal antibody

CATALOG NUMBER: 24009-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPR108 (24009-1-AP) by Proteintech is a Polyclonal antibody targeting GPR108 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24009-1-AP targets GPR108 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GPR108 is a seven-transmembrane family protein that falls in the GPCRs superfamily (PMID:30332431). GPR108 was identified as a highly conserved AAV entry factor implicated in cellular immune responses to AAV (PMID:31784416). Of note is its role in activating nuclear factor kappa-B (NF-κB) signaling, which implied the potential involvement of GPR108 in inflammation-related diseases as well as cancers through dysregulating NF-κB activity (PMID:35659621). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20887 Product name: Recombinant human GPR108 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 433-543 aa of BC007862 Sequence: SVAVNLAKLKLFRHYYVMVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL Predict reactive species Full Name: G protein-coupled receptor 108 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 61-70 kDa GenBank Accession Number: BC007862 Gene Symbol: GPR108 Gene ID (NCBI): 56927 RRID: AB_2879401 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9NPR9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924