Iright
BRAND / VENDOR: Proteintech

Proteintech, 24026-1-AP, CCDC105 Polyclonal antibody

CATALOG NUMBER: 24026-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC105 (24026-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC105 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 24026-1-AP targets CCDC105 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, HeLa cells, SH-SY5Y cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21208 Product name: Recombinant human CCDC105 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 151-499 aa of BC035678 Sequence: VRQLLRQREVTDHRLSEVRKGLLINQQSVKLRGYRPKSEKVPDKADSMLTWEKEELKSMKRKMERDMEKSEVLLKTLASCRDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKRLLVESKDTLVEMAKNEVDVREQQLQISDRVCASLAQKASETLELKERLNMTLGLMRGTILRCTKYNQELYTTHGLIKGPLSKVHLETAEKLDRPLVRMYQRHVGTQLPEAARLAQGTDKLQCHITYLEKNLEELLATHKNLTWGLNCKNIGHEVDGNVVRLRLRQRQPHVCYEQAQRLVKDWDPRTPPPRSKSSADP Predict reactive species Full Name: coiled-coil domain containing 105 Calculated Molecular Weight: 499 aa, 57 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC035678 Gene Symbol: CCDC105 Gene ID (NCBI): 126402 RRID: AB_2879406 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8IYK2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924