Iright
BRAND / VENDOR: Proteintech

Proteintech, 24046-1-AP, ZDHHC9 Polyclonal antibody

CATALOG NUMBER: 24046-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZDHHC9 (24046-1-AP) by Proteintech is a Polyclonal antibody targeting ZDHHC9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24046-1-AP targets ZDHHC9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, SH-SY5Y cells, mouse skeletal muscle tissue, mouse brain tissue Positive IHC detected in: human testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information ZDHHC9, also named as CXorf11, ZDHHC10, ZNF379 or ZNF380, is a 364 amino acid protein, which contains one DHHC-type zinc finger and belongs to the DHHC palmitoyltransferase activity. ZDHHC9 localizes in the endoplasmic reticulum membrane and is highly expressed in kidney, skeletal muscle, brain, lung and liver. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20881 Product name: Recombinant human ZDHHC9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 87-364 aa of BC006200 Sequence: SFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK Predict reactive species Full Name: zinc finger, DHHC-type containing 9 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38-48 kDa GenBank Accession Number: BC006200 Gene Symbol: ZDHHC9 Gene ID (NCBI): 51114 RRID: AB_2879415 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9Y397 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924