Proteintech, 24065-1-AP, NHEDC2 Polyclonal antibody

Size: 20ul / 150ul The NHEDC2 (24065-1-AP) by Proteintech is a Polyclonal antibody targeting NHEDC2 in WB, IHC, ELISA applications with reactivity to human samples 24065-1-AP targets NHEDC2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NHEDC2, also named as NHA2 and SLC9B2, contributes to the organellar volume homeostasis. It is required for osteoclast differentiation and bone resorption activity. NHEDC2 has two isoforms with MW 48 kDa and 58 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21141 Product name: Recombinant human NHEDC2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-156 aa of BC047447 Sequence: MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQRLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLI Predict reactive species Full Name: Na+/H+ exchanger domain containing 2 Calculated Molecular Weight: 537 aa, 58 kDa Observed Molecular Weight: ~55 kDa GenBank Accession Number: BC047447 Gene Symbol: NHEDC2 Gene ID (NCBI): 133308 RRID: AB_2879423 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q86UD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.