Proteintech, 24067-1-AP, CEP120 Polyclonal antibody

Size: 20ul / 150ul The CEP120 (24067-1-AP) by Proteintech is a Polyclonal antibody targeting CEP120 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24067-1-AP targets CEP120 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse lung tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CEP120 encodes a protein that functions in the microtubule-dependent coupling of the nucleus and the centrosome. It is involved in regulating centrosome-mediated interkinetic nuclear migration of neural progenitors (PMID: 27185865, 23857771). CEP120, SPICE1, and CPAP are required for centriole elongation and for the recruitment of distal microtubule-capping proteins and CEP135 to procentrioles (PMID: 23810536). Cep120 and Taccs are required for the neural progenitor pool during mouse neocortical development (PMID: 17920017). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21165 Product name: Recombinant human CEP120 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 85-346 aa of BC040527 Sequence: VTSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYTKFKSEIQISIALETDTKPPVDSFKAKGAPPRDGKVPAILAGLDPRDIVAVLNEEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQIHLCCGDQSLGSTEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQ Predict reactive species Full Name: centrosomal protein 120kDa Calculated Molecular Weight: 986 aa, 113 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC040527 Gene Symbol: CEP120 Gene ID (NCBI): 153241 RRID: AB_3085721 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N960 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.