Proteintech, 24085-1-AP, FRYL Polyclonal antibody

Size: 20ul / 150ul The FRYL (24085-1-AP) by Proteintech is a Polyclonal antibody targeting FRYL in WB, ELISA applications with reactivity to human, mouse samples 24085-1-AP targets FRYL in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: DU 145 cells, HEK-293 cells, HeLa cells, U2OS cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FRYL, or FRY-like transcription coactivator, is a protein that belongs to the Furry protein family, which is evolutionarily conserved from yeast to humans. FRYL has almost identical functional domains to the well-characterized Fry protein, which is involved in many processes, including cell polarization, regulation of the actin cytoskeleton, and patterning of sensory neuron dendritic fields (PMID: 34386489). FRYL is a prognostic marker in certain cancers, including Kidney renal clear cell carcinoma, Ovary serous cystadenocarcinoma, and Rectum adenocarcinoma, suggesting its potential role in cancer progression. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21333 Product name: Recombinant human FRYL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2605-2654 aa of BC021803 Sequence: MPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDG Predict reactive species Full Name: FRY-like Calculated Molecular Weight: 3013 aa, 340 kDa Observed Molecular Weight: 340 kDa GenBank Accession Number: BC021803 Gene Symbol: FRYL Gene ID (NCBI): 285527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O94915 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.