Iright
BRAND / VENDOR: Proteintech

Proteintech, 24104-1-AP, HACE1 Polyclonal antibody

CATALOG NUMBER: 24104-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HACE1 (24104-1-AP) by Proteintech is a Polyclonal antibody targeting HACE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 24104-1-AP targets HACE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information HACE1(E3 ubiquitin-protein ligase HACE1) also named as KIAA1320, has a tumor-suppressor function dependent on its E3 ligase activity and controlling cell cycle progression during cell stress through degradation of cyclin D1. It belongs to the HECT family of E3 ubiqutin protein ligase. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 102 kDa, 36 kDa, 64 kDa and 78 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21130 Product name: Recombinant human HACE1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 564-909 aa of BC034982 Sequence: RSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTTFQPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYELELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA Predict reactive species Full Name: HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 Calculated Molecular Weight: 909 aa, 102 kDa Observed Molecular Weight: 78 kDa GenBank Accession Number: BC034982 Gene Symbol: HACE1 Gene ID (NCBI): 57531 RRID: AB_2879432 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924