Iright
BRAND / VENDOR: Proteintech

Proteintech, 24142-1-AP, PSMC3 Polyclonal antibody

CATALOG NUMBER: 24142-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PSMC3 (24142-1-AP) by Proteintech is a Polyclonal antibody targeting PSMC3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 24142-1-AP targets PSMC3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells, HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, T-47D cells Positive IP detected in: HeLa cells Positive IHC detected in: human ovary tumor tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PSMC3(26S protease regulatory subunit 6A) is also named as TBP1, Proteasome 26S subunit ATPase 3 and belongs to the AAA ATPase family. The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. It is a multifunctional protein, component of the regulatory subunit of the proteasome, involved in different cellular processes. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21408 Product name: Recombinant human PSMC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC008713 Sequence: MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVE Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, ATPase, 3 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC008713 Gene Symbol: PSMC3 Gene ID (NCBI): 5702 RRID: AB_2879440 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P17980 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924