Product Description
Size: 20ul / 150ul
The Multi tags (24147-1-AP) by Proteintech is a Polyclonal antibody targeting Multi tags in WB, ELISA applications with reactivity to human samples
24147-1-AP targets Multi tags in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Transfected HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
This antibody recognize multi tags include: GST tag, 6*HIS tag, DDDDK tag, MYC tag and V5 tag.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21457 Product name: Recombinant Multi tags protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of Sequence: EQKLISEEDLGEQKLISEEDLGEQKLISEEDLGHHHHHHGDYKDDDDKGDYKDDDDKGDYKDDDDKGHHHHHHGYPYDVPDYAGYPYDVPDYAGYPYDVPDYAGHHHHHHGFGKPIPNPLLGLDST Predict reactive species
Full Name: Multi tags
RRID: AB_2879441
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924