Proteintech, 24148-1-AP, COL9A2 Polyclonal antibody

Size: 20ul / 150ul The COL9A2 (24148-1-AP) by Proteintech is a Polyclonal antibody targeting COL9A2 in WB, ELISA applications with reactivity to mouse samples 24148-1-AP targets COL9A2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse ovary tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21458 Product name: Recombinant human COL9A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-406 aa of BC136326 Sequence: EKGDEGSPGIRGPQGITGPKGATGPPGINGKDGTPGTPGMKGSAGQAGQPGSPGHQGLAGVPGQPGTKGGPGDQGEPGPQGLPGFSGPPGKEGEPGPRGEIGPQGIMGQKGDQGERGPVGQPGPQGRQG Predict reactive species Full Name: collagen, type IX, alpha 2 Calculated Molecular Weight: 689 aa, 65 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC136326 Gene Symbol: COL9A2 Gene ID (NCBI): 1298 RRID: AB_3085726 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q14055 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.