Proteintech, 24199-1-AP, IL-28B Polyclonal antibody

Size: 20ul / 150ul The IL-28B (24199-1-AP) by Proteintech is a Polyclonal antibody targeting IL-28B in IF/ICC, ELISA applications with reactivity to human samples 24199-1-AP targets IL-28B in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21491 Product name: Recombinant human IL-28B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-196 aa of BC130316 Sequence: MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV Predict reactive species Full Name: interleukin 28B (interferon, lambda 3) Calculated Molecular Weight: 196 aa, 22 kDa GenBank Accession Number: BC130316 Gene Symbol: IL-28B Gene ID (NCBI): 282617 RRID: AB_2879452 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.