Proteintech, 24201-1-AP, WNT6 Polyclonal antibody

Size: 20ul / 150ul The WNT6 (24201-1-AP) by Proteintech is a Polyclonal antibody targeting WNT6 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24201-1-AP targets WNT6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SGC-7901 cells Positive IHC detected in: mouse brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WNT6 belongs to the Wnt family. It is ligand for members of the frizzled family of seven transmembrane receptors. WNT6 is likely to signal over only few cell diameters. WNT6 may be together with CAV1 to promote chemoresistance of gastric cancer cells to DNA-damaging anthracycline drugs through the activation of the canonical Wnt receptor signaling pathway. And WNT6 is mainly expressed in brain, endometrium epithelium, gastric cancer cell lines and gastric cancer tissues (PMID: 22370641). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20889 Product name: Recombinant human WNT6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 36-365 aa of BC004329 Sequence: DPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL Predict reactive species Full Name: wingless-type MMTV integration site family, member 6 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC004329 Gene Symbol: WNT6 Gene ID (NCBI): 7475 RRID: AB_2879454 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6F9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.