Iright
BRAND / VENDOR: Proteintech

Proteintech, 24215-1-AP, GJB6 Polyclonal antibody

CATALOG NUMBER: 24215-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GJB6 (24215-1-AP) by Proteintech is a Polyclonal antibody targeting GJB6 in IHC, ELISA applications with reactivity to human samples 24215-1-AP targets GJB6 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human oesophagus tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Gap junctions form conduits between adjacent cells that are composed of connexin protein subunits and provide direct intercellular communication pathways allowing rapid exchange of ions and metabolites (PMID: 12126230; 15094343). Connexins are four-pass transmembrane proteins with amino- and carboxy-terminal regions facing the cytoplasm. A connexon is composed of a hexamer of connexins. GJB6 (gap junction beta-6 protein, also known as connexin-30) is a member of the connexin family of proteins. GJB6 is a component of the gap junction networks of the cochlea. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21529 Product name: Recombinant human GJB6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 182-261 aa of BC038934 Sequence: ISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFPS Predict reactive species Full Name: gap junction protein, beta 6, 30kDa Calculated Molecular Weight: 261 aa, 30 kDa GenBank Accession Number: BC038934 Gene Symbol: GJB6 Gene ID (NCBI): 10804 RRID: AB_2879461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O95452 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924