Proteintech, 24294-1-AP, peptide YY Polyclonal antibody

Size: 20ul / 150ul The peptide YY (24294-1-AP) by Proteintech is a Polyclonal antibody targeting peptide YY in IHC, ELISA applications with reactivity to human samples 24294-1-AP targets peptide YY in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human pancreas tissue, human colon tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17939 Product name: Recombinant human PYY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-97 aa of BC041057 Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW Predict reactive species Full Name: peptide YY Calculated Molecular Weight: 97 aa, 11 kDa GenBank Accession Number: BC041057 Gene Symbol: Peptide YY Gene ID (NCBI): 5697 RRID: AB_2879477 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10082 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.