Iright
BRAND / VENDOR: Proteintech

Proteintech, 24302-1-AP, RNF17 Polyclonal antibody

CATALOG NUMBER: 24302-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RNF17 (24302-1-AP) by Proteintech is a Polyclonal antibody targeting RNF17 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 24302-1-AP targets RNF17 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RNF17 also termed as ring finger protein 17 is a 1623 amino acid protein, which contains 1 ring type zinc finger and 4 tudor domains. RNF17 is specifically expressed in testis. The RING finger motif presents in many ubiquitin E3 ligases. RNF17 interacts with all four members of the Mad family (Mad1, Mxi1, Mad3 and Mad4), which are basic-helix-loop-helix-leucine zipper transcription factors of the Myc oncoprotein network. RNF17 is component of the tectonic-like complex, which is required for ciliogenesis and sonic hedgehog/SHH signaling. RNF17 is able to form dimers or polymers both in vitro and in vivo, indicating that it may play a role in the assembly of RNF17 granules. RNF17 encodes a novel key regulator of spermiogenesis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20144 Product name: Recombinant human RNF17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 296-652 aa of BC146822 Sequence: ICMFNNMGKIEFRDSTKCYPQENEIRQNVQKKYNNKKELSCYDTYPPLEKKKVDMSVLTSEAPPPPLQPETNDVHLEAKNFQPQKDVATASPKTIAVLPQMGSSPDVIIEEIIEDNVESSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVNEFCNRSSHLDPSDILELGARIFVSSIKNGMWCRGTITELIPIEGRNTRKPCSPTRLFVHEVALIQIFMVDFGNSEVLIVTGVVDTHVRPEHSAKQHIALNDLCLVLRKSEPYTEGLLKDIQPLAQPCSLKDIVPQNSNEGWEEEAKVEFLKMVNNKAVSMKVFREEDGVLIVDLQKPPPNKISSDMPVSLRDALVFMELAKRT Predict reactive species Full Name: ring finger protein 17 Calculated Molecular Weight: 1623 aa, 185 kDa Observed Molecular Weight: 184 kDa GenBank Accession Number: BC146822 Gene Symbol: RNF17 Gene ID (NCBI): 56163 RRID: AB_2879484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924