Proteintech, 24304-1-AP, cIAP2 Polyclonal antibody

Size: 20ul / 150ul The cIAP2 (24304-1-AP) by Proteintech is a Polyclonal antibody targeting cIAP2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 24304-1-AP targets cIAP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Daudi cells, HeLa cells, RAW 264.7 cells, U-937 cells, Raji cells Positive IP detected in: Daudi cells Positive IHC detected in: human tonsillitis tissue, human lung cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information cIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20143 Product name: Recombinant human BIRC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 78-169 aa of BC027485 Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE Predict reactive species Full Name: baculoviral IAP repeat-containing 3 Calculated Molecular Weight: 604 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC027485 Gene Symbol: cIAP2 Gene ID (NCBI): 330 RRID: AB_2879485 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.