Proteintech, 24306-1-AP, ISLR Polyclonal antibody

Size: 20ul / 150ul The ISLR (24306-1-AP) by Proteintech is a Polyclonal antibody targeting ISLR in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse samples 24306-1-AP targets ISLR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, rat thyroid gland tissue, mouse retina tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells, A549 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The Immunoglobulin superfamily containing leucine-rich repeat protein(ISLR), is involved in various biological events, such as embryonic development, Gaucher's disease, and replicative senescence of fibroblasts in some organs, including the heart, pancreas, and bone marrow. ISLR, also known as meflin, is a newly discovered marker of mesenchymal stem cells, which is involved in pathological fibrosis and the cancer microenvironment. (PMID: 34713300) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19446 Product name: Recombinant human ISLR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 318-402 aa of BC022478 Sequence: GKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAE Predict reactive species Full Name: immunoglobulin superfamily containing leucine-rich repeat Calculated Molecular Weight: 428 aa, 46 kDa Observed Molecular Weight: 44-46 kDa GenBank Accession Number: BC022478 Gene Symbol: ISLR Gene ID (NCBI): 3671 RRID: AB_3085729 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14498 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.