Proteintech, 24324-1-AP, Sodium iodide symporter Polyclonal antibody

Size: 20ul / 150ul The Sodium iodide symporter (24324-1-AP) by Proteintech is a Polyclonal antibody targeting Sodium iodide symporter in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 24324-1-AP targets Sodium iodide symporter in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse stomach tissue, SGC-7901 cells, rat stomach tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse stomach tissue, human ovary tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The sodium iodide symporter (Na+/I - symporter, NIS), encoded by SLC5A5, is an integral plasma membrane glycoprotein that plays an important role in iodide uptake by thyroid cells. Expression of sodium iodide symporter has also been found in extra-thyroidal tissues, including gastric mucosa, lactating mammary gland and salivary glands. Increased expression of sodium iodide symporter has been found in thyroid tissue from patients with Graves' disease as well as papillary thyroid carcinomas. In addition, sodium iodide symporter was found to express in majority of breast cancer tissue but not in normal tissue. Sodium iodide symporter can be a promising diagnostic and therapeutic tool for thyroid cancer and breast cancer. This antibody recognizes the mature approximately 75-100 kDa protein and a partially glycosylated 50-55 kDa protein. (PMID: 12588808, 9525971) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19504 Product name: Recombinant human SLC5A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 538-643 aa of BC105047 Sequence: TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL Predict reactive species Full Name: solute carrier family 5 (sodium iodide symporter), member 5 Calculated Molecular Weight: 643 aa, 69 kDa Observed Molecular Weight: 50-55 kDa, 75-100 kDa GenBank Accession Number: BC105047 Gene Symbol: Sodium iodide symporter Gene ID (NCBI): 6528 RRID: AB_2879495 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92911 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.