Iright
BRAND / VENDOR: Proteintech

Proteintech, 24331-1-AP, TMEM9B Polyclonal antibody

CATALOG NUMBER: 24331-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM9B (24331-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM9B in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples 24331-1-AP targets TMEM9B in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: rat liver tissue, mouse colon tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TMEM9B, also termed as Transmembrane protein 9B encodes a 198 amino-acidprotein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites, and three conserved cys-rich domains in the N-terminus. There is a dimer form of TMEM9B protein (PMID: 12359240). TMEM9B mRNA is expressed in a wide range of tissues and cells. TMEM9B is a lysosomal transmembrane protein that regulates the activity of inflammatory signaling pathways. Specification Tested Reactivity: human, rat, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19383 Product name: Recombinant human TMEM9B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 80-172 aa of BC040124 Sequence: PDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKV Predict reactive species Full Name: TMEM9 domain family, member B Calculated Molecular Weight: 198 aa, 23 kDa Observed Molecular Weight: 23 kDa, 35 kDa GenBank Accession Number: BC040124 Gene Symbol: TMEM9B Gene ID (NCBI): 56674 RRID: AB_2879497 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ34 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924