Iright
BRAND / VENDOR: Proteintech

Proteintech, 24338-1-AP, IFT43 Polyclonal antibody

CATALOG NUMBER: 24338-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IFT43 (24338-1-AP) by Proteintech is a Polyclonal antibody targeting IFT43 in IHC, IF/ICC, ELISA applications with reactivity to human, canine samples 24338-1-AP targets IFT43 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MDCK cells, hTERT-RPE1 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IFT43, encoded by C14ORF179, is a subunit of the intraflagellar transport complex A (IFT-A) of primary cilia. The IFT-A is implicated in retrograde ciliary transport along axonemal microtubules. Defects in subunits of IFT-A has been associated with skeletal ciliopathies, including Sensenbrenner syndrome, Jeune syndrome, and Ellis-van-Creveld syndrome. Mutations in C14ORF179 has been linked to Sensenbrenner syndrome. (21378380) Specification Tested Reactivity: human, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19434 Product name: Recombinant human C14orf179 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-213 aa of BC010436 Sequence: MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT Predict reactive species Full Name: chromosome 14 open reading frame 179 Calculated Molecular Weight: 213 aa, 24 kDa GenBank Accession Number: BC010436 Gene Symbol: IFT43 Gene ID (NCBI): 112752 RRID: AB_2749824 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96FT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924