Product Description
Size: 20ul / 150ul
The UGT2A1 (24343-1-AP) by Proteintech is a Polyclonal antibody targeting UGT2A1 in WB, ELISA applications with reactivity to human, rat samples
24343-1-AP targets UGT2A1 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells, C6 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Specification
Tested Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19421 Product name: Recombinant human UGT2A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-124 aa of BC157012 Sequence: PMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYRVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQE Predict reactive species
Full Name: UDP glucuronosyltransferase 2 family, polypeptide A1
Calculated Molecular Weight: 527 aa, 60 kDa
Observed Molecular Weight: 50-53 kDa
GenBank Accession Number: BC157012
Gene Symbol: UGT2A1
Gene ID (NCBI): 10941
RRID: AB_2879502
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P0DTE4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924