Proteintech, 24391-1-AP, GPR152 Polyclonal antibody

Size: 20ul / 150ul The GPR152 (24391-1-AP) by Proteintech is a Polyclonal antibody targeting GPR152 in IHC, ELISA applications with reactivity to human, mouse samples 24391-1-AP targets GPR152 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse spleen tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR152 (G Protein-Coupled Receptor 152) is a G protein-coupled receptor. GPR152 is primarily expressed in the central nervous system (PMID: 15777626). Its role in GPCR signaling pathways suggests potential involvement in various physiological processes. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18420 Product name: Recombinant human GPR152 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 303-470 aa of BC122869 Sequence: RTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQPQSDPTAQPQLNLMAQPQSDSVAQPQADTNVQTPAPAASSVPSPCDEASPTPSSHPTPGALEDPATPPASEGESPSSTPPEAAPGAGPT Predict reactive species Full Name: G protein-coupled receptor 152 Calculated Molecular Weight: 470 aa, 51 kDa GenBank Accession Number: BC122869 Gene Symbol: GPR152 Gene ID (NCBI): 390212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.