Proteintech, 24399-1-AP, GPATCH4 Polyclonal antibody

Size: 20ul / 150ul The GPATCH4 (24399-1-AP) by Proteintech is a Polyclonal antibody targeting GPATCH4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24399-1-AP targets GPATCH4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information GPATCH4 (G patch domain-containing protein 4) is a 446 amino acid protein containing one G-patch domain. Existing as three alternatively spliced isoforms. This antibody is a rabbit polyclonal antibody raised against the 189 residues of N-terminal of human GPATCH4 protein Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20095 Product name: Recombinant human GPATCH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC040147 Sequence: MKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRYNHPKPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQAFLARLKGQDPGAPQLQSESK Predict reactive species Full Name: G patch domain containing 4 Calculated Molecular Weight: 446 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC040147 Gene Symbol: GPATCH4 Gene ID (NCBI): 54865 RRID: AB_2879523 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T3I0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.