Iright
BRAND / VENDOR: Proteintech

Proteintech, 24401-1-AP, Collagen Type XXVIII Polyclonal antibody

CATALOG NUMBER: 24401-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Collagen Type XXVIII (24401-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type XXVIII in WB, IF/ICC, ELISA applications with reactivity to human samples 24401-1-AP targets Collagen Type XXVIII in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COL28A1 (collagen type XXVIII alpha 1 chain), also known as COL28. It is expected to be located in the basement membranes, cytoplasm and nucleus. And the protein is mainly expressed in salivary gland and adrenal. This antibody can recognize the 117 kDa and 72 kDa isoforms of target. COL28A1 is a new collagen that cannot clearly be assigned to any collagen subgroup, despite the fact that it contains VWA domains. Ongoing investigations will shed further light on the role of COL28A1 in the assembly of nerve fiber basement membranes. Although no human mutation has been associated with COL28A1, it is tempting to speculate that mutations in this gene would lead to neurodegenerative disease (PMID: 16330543). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21459 Product name: Recombinant human COL28A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-295 aa of BC136892 Sequence: LARKSDVQGSICFIDIVFIVDSSESSKIALFDKQKDFVDSLSDKIFQLTPGRSLEYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQKVKSMNLIGQGTFSYYAISNATRLLKREGRKDGVKVVLLMTDGIDHPKNPDVQSISEDARISGISFITIGLSTVVNEAKLRLISGDSSSEPTLLLSDPTLVDKIQDRLDILFEKKCERKICECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGNAQKGEAGERGPGGIPGYKGDKG Predict reactive species Full Name: collagen, type XXVIII, alpha 1 Calculated Molecular Weight: 1125 aa, 117 kDa Observed Molecular Weight: 72 kDa, 100-117 kDa GenBank Accession Number: BC136892 Gene Symbol: COL28A1 Gene ID (NCBI): 340267 RRID: AB_3669435 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2UY09 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924