Iright
BRAND / VENDOR: Proteintech

Proteintech, 24408-1-AP, MICALL2 Polyclonal antibody

CATALOG NUMBER: 24408-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MICALL2 (24408-1-AP) by Proteintech is a Polyclonal antibody targeting MICALL2 in WB, ELISA applications with reactivity to human samples 24408-1-AP targets MICALL2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, PC-3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19931 Product name: Recombinant human MICALL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-605 aa of BC037988 Sequence: PAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLK Predict reactive species Full Name: MICAL-like 2 Calculated Molecular Weight: 904 aa, 98 kDa Observed Molecular Weight: 109 kDa GenBank Accession Number: BC037988 Gene Symbol: MICALL2 Gene ID (NCBI): 79778 RRID: AB_2879527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IY33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924