Iright
BRAND / VENDOR: Proteintech

Proteintech, 24419-1-AP, FAM48A Polyclonal antibody

CATALOG NUMBER: 24419-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FAM48A (24419-1-AP) by Proteintech is a Polyclonal antibody targeting FAM48A in WB, IHC, ELISA applications with reactivity to human samples 24419-1-AP targets FAM48A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, Jurkat cells Positive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM48A also named as C13orf19 or SUPT20H is a 779 amino acid protein, which belongs to the SPT20 family. FAM48A is required for MAP kinase p38 activation during gastrulation and for starvation-induced ATG9A trafficking during autophagy. FAM48A localizes in the nucleus and is highly expressed in testis, moderately in brain and pituitary gland. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19875 Product name: Recombinant human FAM48A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 482-701 aa of BC030686 Sequence: TPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVL Predict reactive species Full Name: family with sequence similarity 48, member A Calculated Molecular Weight: 779 aa, 86 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC030686 Gene Symbol: FAM48A Gene ID (NCBI): 55578 RRID: AB_2879537 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924