Proteintech, 24420-1-AP, MPND Polyclonal antibody

Size: 20ul / 150ul The MPND (24420-1-AP) by Proteintech is a Polyclonal antibody targeting MPND in WB, ELISA applications with reactivity to human, mouse samples 24420-1-AP targets MPND in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SMMC-7721 cells, HepG2 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19531 Product name: Recombinant human MPND protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC032652 Sequence: MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTS Predict reactive species Full Name: MPN domain containing Calculated Molecular Weight: 471 aa, 51 kDa Observed Molecular Weight: 49-55 kDa GenBank Accession Number: BC032652 Gene Symbol: MPND Gene ID (NCBI): 84954 RRID: AB_2879538 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N594 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.