Iright
BRAND / VENDOR: Proteintech

Proteintech, 24435-1-AP, L3MBTL2 Polyclonal antibody

CATALOG NUMBER: 24435-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The L3MBTL2 (24435-1-AP) by Proteintech is a Polyclonal antibody targeting L3MBTL2 in WB, ELISA applications with reactivity to human samples 24435-1-AP targets L3MBTL2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information L3MBTL2 (Lethal (3) malignant brain tumor like 2) is a member of the MBT-domain proteins, which are involved in transcriptional repression and implicated in chromatin compaction. L3MBTL2 was most highly expressed in pachytene spermatocytes within the testis (PMID: 30760872).In addition, mutations in L3MBTL2 are prevalent in various cancers including leukemia, a disease characterized by alterations in multiple DNA repair proteins (PMID: 29581593). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19571 Product name: Recombinant human L3MBTL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 284-427 aa of BC017191 Sequence: RTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMAHHPTFRKIYCDAVPYLFKKVRAVYTEGGW Predict reactive species Full Name: l(3)mbt-like 2 (Drosophila) Calculated Molecular Weight: 705 aa, 79 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: BC017191 Gene Symbol: L3MBTL2 Gene ID (NCBI): 83746 RRID: AB_3085733 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924