Iright
BRAND / VENDOR: Proteintech

Proteintech, 24449-1-AP, CCBE1 Polyclonal antibody

CATALOG NUMBER: 24449-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCBE1 (24449-1-AP) by Proteintech is a Polyclonal antibody targeting CCBE1 in IHC, ELISA applications with reactivity to human samples 24449-1-AP targets CCBE1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCBE1 (collagen and calcium-binding EGF domain-containing protein 1) is a secreted protein that is indispensible for lymphangiogenesis during development. CCBE1 may be a guidance molecule that regulates lymphangioblast budding and possibly migration (PMID: 19287381). The gene of CCBE1 maps to 18q21.32 and encodes a protein of 44 kDa that contains an EGF-like domain and two collagen-like domains. Mutations in the CCBE1 gene cause Hennekam lymphangiectasia-lymphedema syndrome (PMID: 19935664). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19686 Product name: Recombinant human CCBE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC046645 Sequence: MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP Predict reactive species Full Name: collagen and calcium binding EGF domains 1 Calculated Molecular Weight: 406 aa, 44 kDa GenBank Accession Number: BC046645 Gene Symbol: CCBE1 Gene ID (NCBI): 147372 RRID: AB_2879553 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924