Iright
BRAND / VENDOR: Proteintech

Proteintech, 24453-1-AP, ABCG8 Polyclonal antibody

CATALOG NUMBER: 24453-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ABCG8 (24453-1-AP) by Proteintech is a Polyclonal antibody targeting ABCG8 in WB, ELISA applications with reactivity to human, rat samples 24453-1-AP targets ABCG8 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HL-60 cells, PC-12 cells, k-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ABCG8(ATP-binding cassette sub-family G member 8) and ABCG5(ATP-binding cassette protein G5) are members of the ABC transporter family and are half-type ABC transporters, which consist of six transmembrane helices and one nucleotide-binding domain. ABCG5 and ABCG8 form a heterodimer (ABCG5/ABCG8). Mutations in either ABCG5 or ABCG8 cause a genetic disorder, sitosterolemia. Patients with sitosterolemia show high plant sterol levels and develop hypercholesterolemia and atherosclerosis at a young age.(PMID: 36839356) Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19879 Product name: Recombinant human ABCG8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-386 aa of BC113657 Sequence: SGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLASQVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFSQAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCL Predict reactive species Full Name: ATP-binding cassette, sub-family G (WHITE), member 8 Calculated Molecular Weight: 673 aa, 76 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC113657 Gene Symbol: ABCG8 Gene ID (NCBI): 64241 RRID: AB_3085735 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924