Proteintech, 24467-1-AP, FAM47B Polyclonal antibody

Size: 20ul / 150ul The FAM47B (24467-1-AP) by Proteintech is a Polyclonal antibody targeting FAM47B in WB, ELISA applications with reactivity to human, mouse, rat samples 24467-1-AP targets FAM47B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FAM47B(Family with sequence similarity 47 member B) belongs to the FAM47 family and is expressed in testis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21562 Product name: Recombinant human FAM47B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-412 aa of BC035026 Sequence: RPEPSKTQVSSLCPEPPEAGVSHLCLEPPNTHRVSSFLLQVLKLDSEKKLEDARARCEGQEMTTEELTKPGKYHFWESCPRPFESRMPHLRLVLPITRRMASLCL Predict reactive species Full Name: family with sequence similarity 47, member B Calculated Molecular Weight: 645 aa, 74 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC035026 Gene Symbol: FAM47B Gene ID (NCBI): 170062 RRID: AB_3669438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.