Product Description
Size: 20ul / 150ul
The FAM47B (24467-1-AP) by Proteintech is a Polyclonal antibody targeting FAM47B in WB, ELISA applications with reactivity to human, mouse, rat samples
24467-1-AP targets FAM47B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse testis tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
FAM47B(Family with sequence similarity 47 member B) belongs to the FAM47 family and is expressed in testis.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21562 Product name: Recombinant human FAM47B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-412 aa of BC035026 Sequence: RPEPSKTQVSSLCPEPPEAGVSHLCLEPPNTHRVSSFLLQVLKLDSEKKLEDARARCEGQEMTTEELTKPGKYHFWESCPRPFESRMPHLRLVLPITRRMASLCL Predict reactive species
Full Name: family with sequence similarity 47, member B
Calculated Molecular Weight: 645 aa, 74 kDa
Observed Molecular Weight: 70 kDa
GenBank Accession Number: BC035026
Gene Symbol: FAM47B
Gene ID (NCBI): 170062
RRID: AB_3669438
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8NA70
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924