Proteintech, 24488-1-AP, DNAH17 Polyclonal antibody

Size: 20ul / 150ul The DNAH17 (24488-1-AP) by Proteintech is a Polyclonal antibody targeting DNAH17 in WB, IHC, ELISA applications with reactivity to human samples 24488-1-AP targets DNAH17 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20033 Product name: Recombinant human DNAH17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 299-644 aa of BC112284 Sequence: MEQADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLKGLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKDKEPVPWEFPSSLAFSRINSFFQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLDPGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAEVAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLEVSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQW Predict reactive species Full Name: dynein, axonemal, heavy chain 17 Calculated Molecular Weight: 4485 aa, 512 kDa Observed Molecular Weight: 500-512 kDa GenBank Accession Number: BC112284 Gene Symbol: DNAH17 Gene ID (NCBI): 8632 RRID: AB_2879568 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UFH2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.