Iright
BRAND / VENDOR: Proteintech

Proteintech, 24490-1-AP, RRP7A Polyclonal antibody

CATALOG NUMBER: 24490-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RRP7A (24490-1-AP) by Proteintech is a Polyclonal antibody targeting RRP7A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24490-1-AP targets RRP7A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue Positive IHC detected in: human placenta tissue, human brain tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information RRP7A, also named as Ribosomal RNA-processing protein 7 homolog A, is a 280 amino acid protein, which belongs to the RRP7 family. The calcualted molecular weight of RRP7A is 32 kDa, but modified RRP7A is about 42 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21636 Product name: Recombinant human RRP7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC121118 Sequence: MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTF Predict reactive species Full Name: ribosomal RNA processing 7 homolog A (S. cerevisiae) Calculated Molecular Weight: 280 aa, 32 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC121118 Gene Symbol: RRP7A Gene ID (NCBI): 27341 RRID: AB_2879570 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3A4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924