Iright
BRAND / VENDOR: Proteintech

Proteintech, 24513-1-AP, CPS1 Polyclonal antibody

CATALOG NUMBER: 24513-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CPS1 (24513-1-AP) by Proteintech is a Polyclonal antibody targeting CPS1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24513-1-AP targets CPS1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, mouse liver tissue, rat liver tissue, L02 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Carbamoyl phosphate synthetase 1 (CPS1) is the first rate-limiting enzyme in the urea cycle, converting ammonium into carbamoyl phosphate, and plays an intricate role in arginine metabolism and pyrimidine metabolism (PMID: 28376202). CPS1 expression is liver specific and suppressed in HCC cells and tumor tissues at the transcriptional level(PMID: 21281797). CPS1 gene comprises 38 exons that encode a polypeptide of 1500 amino acids and has a molecular weight of 165 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21605 Product name: Recombinant human CPS1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1361-1500 aa of BC140943 Sequence: GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA Predict reactive species Full Name: carbamoyl-phosphate synthetase 1, mitochondrial Calculated Molecular Weight: 1500 aa, 165 kDa Observed Molecular Weight: 140-165 kDa GenBank Accession Number: BC140943 Gene Symbol: CPS1 Gene ID (NCBI): 1373 RRID: AB_2879583 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31327 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924