Proteintech, 24514-1-AP, ZNF846 Polyclonal antibody

Size: 20ul / 150ul The ZNF846 (24514-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF846 in WB, ELISA applications with reactivity to human, rat samples 24514-1-AP targets ZNF846 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ZNF846 also termed as zinc finger protein 846 is a 533 amino-acid protein, which contains 1 KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF846 localizes in the nucleus and may play an important role in transcription regulation. The function of ZNF846 is still non-known and need to be further studied. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21687 Product name: Recombinant human ZNF846 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-55 aa of BC118657 Sequence: AFTQSTGLKLHIRTHSGEKPYKCKECGKAFTHSSYLTDHTRIHSGKKPYVCMECG Predict reactive species Full Name: zinc finger protein 846 Calculated Molecular Weight: 533 aa, 61 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC118657 Gene Symbol: ZNF846 Gene ID (NCBI): 162993 RRID: AB_2879584 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q147U1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.