Iright
BRAND / VENDOR: Proteintech

Proteintech, 24539-1-AP, TMEM120B Polyclonal antibody

CATALOG NUMBER: 24539-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM120B (24539-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM120B in WB, ELISA applications with reactivity to human, mouse samples 24539-1-AP targets TMEM120B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TMEM120B also named as transmembrane protein 120B is 339 amino acid multi-pass membrane protein, which belongs to the TMEM120 family and localizes in membrane. The function of TMEM120B is still non-known. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21609 Product name: Recombinant human TMEM120B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-83 aa of BC127768 Sequence: MSGQLERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANI Predict reactive species Full Name: transmembrane protein 120B Calculated Molecular Weight: 339 aa, 40 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC127768 Gene Symbol: TMEM120B Gene ID (NCBI): 144404 RRID: AB_2879596 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0PK00 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924