Proteintech, 24544-1-AP, ZBTB8A Polyclonal antibody

Size: 20ul / 150ul The ZBTB8A (24544-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB8A in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 24544-1-AP targets ZBTB8A in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information ZBTB8A, also named as Zinc finger and BTB domain-containing protein 8A, is a 441 amino acid protein, which may be involved in transcriptional regulation. ZBTB8A may be a potential carcinogenic factor in gastric carcinoma, and may also be involved in gastric adenocarcinoma cell differentiation, cancer invasion and metastasis. The calcualted molecular weight of ZBTB8A is 50 kDa, but modified ZBTB8A is about 55-60 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21588 Product name: Recombinant human ZBTB8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 106-296 aa of BC015239 Sequence: QMTDVISVCKTFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQPLAKHEPRKESIKKTKHLRLSQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYCTHVVKRKAD Predict reactive species Full Name: zinc finger and BTB domain containing 8A Calculated Molecular Weight: 441 aa, 50 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC015239 Gene Symbol: ZBTB8A Gene ID (NCBI): 653121 RRID: AB_2879599 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BR9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.