Iright
BRAND / VENDOR: Proteintech

Proteintech, 24552-1-AP, CD41 Polyclonal antibody

CATALOG NUMBER: 24552-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD41 (24552-1-AP) by Proteintech is a Polyclonal antibody targeting CD41 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 24552-1-AP targets CD41 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat blood, mouse spleen tissue, rat spleen tissue, human blood tissue Positive IP detected in: human plasma tissue Positive IHC detected in: mouse spleen tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID: 19118207). Integrin alpha-IIb (ITGA2B, CD41) is expressed on platelets, megakaryocytes and some hematopoietic progenitor cells (PMID: 11934866). This protein undergoes post-translational cleavage to yield disulfide linked light beta (25 kDa) and heavy alpha (125 kDa) chains, which join with integrin beta3 (CD61) to form a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. CD41/CD61 is crucial for platelet aggregation through binding of soluble fibrinogen. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19459 Product name: Recombinant human CD41/Integrin alpha 2b protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 678-894 aa of BC126442 Sequence: AELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFL Predict reactive species Full Name: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) Calculated Molecular Weight: 1039 aa, 113 kDa Observed Molecular Weight: 110-125 kDa GenBank Accession Number: BC126442 Gene Symbol: CD41 Gene ID (NCBI): 3674 RRID: AB_2879604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08514 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924