Proteintech, 24560-1-AP, FYTTD1 Polyclonal antibody

Size: 20ul / 150ul The FYTTD1 (24560-1-AP) by Proteintech is a Polyclonal antibody targeting FYTTD1 in WB, ELISA applications with reactivity to human samples 24560-1-AP targets FYTTD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information FYTTD1, also termed as UAP56 interacting factor or UIF, is a 318 amino acid protein, that belongs to the UIF family. FYTTD1 localizes to the nucleus and is required for mRNA export from the nucleus to the cytoplasm. Functioning as an adaptor, FYTTD1 utilizes the BAT1/DDX39-TAP pathway, which is essential for efficient mRNA export and nuclear pore delivery. FYTTD1 interacts with SSRP1, a protein that is necessary for its recruitment of mRNAs, in addition to a mutually exclusive interaction with BAT1/DDX39 and TAP. The molecular weight of post-translational modified FYTTD1 is observed to be 50 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20051 Product name: Recombinant human FYTTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-128 aa of BC039734 Sequence: MRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDK Predict reactive species Full Name: forty-two-three domain containing 1 Calculated Molecular Weight: 318 aa, 36 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC039734 Gene Symbol: FYTTD1 Gene ID (NCBI): 84248 RRID: AB_2879609 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QD9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.