Product Description
Size: 20ul / 150ul
The PCOTH (24564-1-AP) by Proteintech is a Polyclonal antibody targeting PCOTH in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
24564-1-AP targets PCOTH in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse testis tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: PC-3 cells
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
PCOTH may be involved in growth and survival of prostate cancer cells through the TAF-Ibeta pathway.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20092 Product name: Recombinant human PCOTH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-107 aa of BC142999 Sequence: GTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP Predict reactive species
Full Name: prostate collagen triple helix
Calculated Molecular Weight: 107 aa, 11 kDa
GenBank Accession Number: BC142999
Gene Symbol: PCOTH
Gene ID (NCBI): 542767
RRID: AB_2918084
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q58A44
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924