Proteintech, 24568-1-AP, SUN1 Polyclonal antibody

Size: 20ul / 150ul The SUN1 (24568-1-AP) by Proteintech is a Polyclonal antibody targeting SUN1 in WB, IP, ELISA applications with reactivity to human samples 24568-1-AP targets SUN1 in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, Jurkat cells, K-562 cells, HeLa cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21117 Product name: Recombinant human UNC84A protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 4-257 aa of BC013613 Sequence: SRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP Predict reactive species Full Name: unc-84 homolog A (C. elegans) Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC013613 Gene Symbol: SUN1 Gene ID (NCBI): 23353 RRID: AB_2879612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94901 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.