Proteintech, 24576-1-AP, RIM1 Polyclonal antibody

Size: 20ul / 150ul The RIM1 (24576-1-AP) by Proteintech is a Polyclonal antibody targeting RIM1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 24576-1-AP targets RIM1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RIMS1 is a RAS gene superfamily member that regulates synaptic vesicle exocytosis. RIMS1 also plays a role in the regulation of voltage-gated calcium channels during neurotransmitter and insulin release. Mutations in RIMS1 have suggested a role cognition and have been identified as the cause of cone-rod dystrophy type 7. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20161 Product name: Recombinant human RIMS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 923-1039 aa of BC152435 Sequence: KSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTR Predict reactive species Full Name: regulating synaptic membrane exocytosis 1 Calculated Molecular Weight: 1692 aa, 189 kDa Observed Molecular Weight: 189 kDa GenBank Accession Number: BC152435 Gene Symbol: RIMS1 Gene ID (NCBI): 22999 RRID: AB_2879618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.