Proteintech, 24578-1-AP, HEATR2 Polyclonal antibody

Size: 20ul / 150ul The HEATR2 (24578-1-AP) by Proteintech is a Polyclonal antibody targeting HEATR2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 24578-1-AP targets HEATR2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HEATR2 also termed as HEAT repeat containing 2 is an 855 amino acid protein. HEATR2 is a member of a family of ten other uncharacterized HEAT-repeat-containing proteins, which contains HEAT (Huntingtin, elongation factor 3 (EF3), protein phosphatase 2A (PP2A) and the yeast PI3-kinase Tor1) repeats. HEAT repeats form rod-like helical structures that are involved in intracellular transport. HEATR2 play an important role in dynein arm transportation or assembly. HEATR2 mutation is implicated in Primary ciliary dyskinesia 18. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20080 Product name: Recombinant human HEATR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 661-809 aa of BC047240 Sequence: NLQWHAGRTAAAIRTAAVSCLWALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEKLIRIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLDDPERAIQDAI Predict reactive species Full Name: HEAT repeat containing 2 Calculated Molecular Weight: 855 aa, 94 kDa Observed Molecular Weight: 93 kDa GenBank Accession Number: BC047240 Gene Symbol: HEATR2 Gene ID (NCBI): 54919 RRID: AB_2827668 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86Y56 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.