Product Description
Size: 20ul / 150ul
The SLCO4C1 (24584-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO4C1 in WB, IHC, ELISA applications with reactivity to human, mouse samples
24584-1-AP targets SLCO4C1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: human plasma, mouse kidney tissue
Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Background Information
SLCO4C1 is the only OATP ( organic anion transporting polypeptide) expressed at the human kidney's basolateral side of proximal tubular cells and mediates the excretion of uremic toxins (PMID: 21656517).
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20177 Product name: Recombinant human SLCO4C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC152989 Sequence: MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG Predict reactive species
Full Name: solute carrier organic anion transporter family, member 4C1
Calculated Molecular Weight: 724 aa, 79 kDa
Observed Molecular Weight: 60-85 kDa
GenBank Accession Number: BC152989
Gene Symbol: SLCO4C1
Gene ID (NCBI): 353189
RRID: AB_2879622
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6ZQN7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924